Structure of PDB 8cre Chain Y

Receptor sequence

>8creY (length=129) Species: 5476 (Candida albicans)

TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLTVMQKHGYIGEFE
YIDDHRSGKIVVQLNGRLNKCGVIQPRFNVKINDIERWTDNLLPARQFGY
VILTTSAGIMDHEEARRKHVSGKILGFVY

3D structure

• PDB: 8cre Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
• Chain: Y
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y	T2 R3 T4 V6 A8 D9 N12 N16 R28 S30 S31 K32 H56 R57 S58 K71 V74 I75 Q76 R78 N80 K82 I83 R88 W89 T105 T106 S107 R118 K119 H120 S122 Y130	T1 R2 T3 V5 A7 D8 N11 N15 R27 S29 S30 K31 H55 R56 S57 K70 V73 I74 Q75 R77 N79 K81 I82 R87 W88 T104 T105 S106 R117 K118 H119 S121 Y129
BS02	MG	Y	R97 F99	R96 F98

External links

• PDB: RCSB:8cre, PDBe:8cre, PDBj:8cre
• PDBsum: 8cre
• UniProt: A0A8H6F0N4