Structure of PDB 8cg8 Chain Y

Receptor sequence
>8cg8Y (length=52) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
IIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPKKK
LK
3D structure
PDB8cg8 Cryo-EM analysis of eukaryotic ribosome translocation intermediates
ChainY
Resolution2.57 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y R97 Y100 R102 P104 R106 N109 R111 K112 R113 K114 G116 H117 N119 R122 K124 K125 K128 R21 Y24 R26 P28 R30 N33 R35 K36 R37 K38 G40 H41 N43 R46 K48 K49 K52
BS02 ZN Y C96 C99 C110 C115 C20 C23 C34 C39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000055 ribosomal large subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0016567 protein ubiquitination
GO:0019941 modification-dependent protein catabolic process
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cg8, PDBe:8cg8, PDBj:8cg8
PDBsum8cg8
PubMed38030725
UniProtP0CH08|RL40A_YEAST Ubiquitin-ribosomal protein eL40A fusion protein (Gene Name=RPL40A)

[Back to BioLiP]