Structure of PDB 8cbj Chain Y

Receptor sequence

>8cbjY (length=134) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]

SDAVTIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEVYKAE
KDAVSVFGFRTQFGGGKSVGFGLVYNSVAEAKKFEPTYRLVRYGLAEKVE
KASRQQRKQKKNRDKKIFGTGKRLAKKVARRNAD

3D structure

PDB

8cbj Molecular basis for recognition and deubiquitination of 40S ribosomes by Otu2.

Chain

Resolution

3.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y	R8 T9 R10 K11 V12 K21 A33 N34 K37 K49 G59 F60 T62 Q63 F64 K84 Y89 R93 S104 R105 Q106 R108 K109 Q110 K112 N113 K116 K117 G120 T121 K123 R124 K127 K128 R131 R132	R7 T8 R9 K10 V11 K20 A32 N33 K36 K48 G58 F59 T61 Q62 F63 K83 Y88 R92 S103 R104 Q105 R107 K108 Q109 K111 N112 K115 K116 G119 T120 K122 R123 K126 K127 R130 R131

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8cbj, PDBe:8cbj, PDBj:8cbj
PDBsum	8cbj
PubMed	37169754
UniProt	P0CX31\|RS24A_YEAST Small ribosomal subunit protein eS24A (Gene Name=RPS24A)