Structure of PDB 8buu Chain Y

Receptor sequence
>8buuY (length=66) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIREVRKAI
ARMKTVIREREIAANK
3D structure
PDB8buu Genome-encoded ABCF factors implicated in intrinsic antibiotic resistance in Gram-positive bacteria: VmlR2, Ard1 and CplR.
ChainY
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y A3 R7 L32 N39 T40 A41 R44 E45 R47 K48 A51 R52 K54 T55 R58 A3 R7 L32 N39 T40 A41 R44 E45 R47 K48 A51 R52 K54 T55 R58
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8buu, PDBe:8buu, PDBj:8buu
PDBsum8buu
PubMed36951104
UniProtP12873|RL29_BACSU Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]