Structure of PDB 7zhs Chain Y

Receptor sequence
>7zhsY (length=143) Species: 9606,559292 [Search protein sequence]
GEDMMHPLKVSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSAC
RGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKVIK
EVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVLLLQEK
3D structure
PDB7zhs The class A Hsp40 DnaJA2 self-associates into ordered, highly dynamic tubular oligomers that productively interact with unfolded substrates and Hsc70
ChainY
Resolution6.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN Y C73 C76 C135 C31 C34 C93
BS02 ZN Y C89 C92 C116 C119 C47 C50 C74 C77
Gene Ontology
Molecular Function
GO:0001671 ATPase activator activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0030544 Hsp70 protein binding
GO:0031072 heat shock protein binding
GO:0031386 protein tag activity
GO:0042802 identical protein binding
GO:0044389 ubiquitin-like protein ligase binding
GO:0046872 metal ion binding
GO:0051082 unfolded protein binding
GO:0051087 protein-folding chaperone binding
Biological Process
GO:0006457 protein folding
GO:0008284 positive regulation of cell population proliferation
GO:0009408 response to heat
GO:0016925 protein sumoylation
GO:0042026 protein refolding
Cellular Component
GO:0000794 condensed nuclear chromosome
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005940 septin ring
GO:0016020 membrane
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zhs, PDBe:7zhs, PDBj:7zhs
PDBsum7zhs
PubMed37670029
UniProtO60884;
Q12306|SMT3_YEAST Ubiquitin-like protein SMT3 (Gene Name=SMT3)

[Back to BioLiP]