Structure of PDB 7vrj Chain Y

Receptor sequence
>7vrjY (length=63) Species: 553982 (Allochromatium tepidum) [Search protein sequence]
MSPDLWKIWLLIDPRRVLIAVFAFLTILGLAIHMILLSTTEFNWLEDGIP
AAKVQQTPVVPQR
3D structure
PDB7vrj A Ca 2+ -binding motif underlies the unusual properties of certain photosynthetic bacterial core light-harvesting complexes.
ChainY
Resolution2.81 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CRT Y L30 H33 L30 H33
BS02 BCL Y F22 L25 H33 W44 F22 L25 H33 W44
BS03 CA Y W44 D47 I49 W44 D47 I49
BS04 BCL Y L28 G29 I32 H33 L28 G29 I32 H33
BS05 CRT Y I8 L11 I8 L11
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Wed Nov 27 21:53:01 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7vrj', asym_id = 'Y', title = 'A Ca 2+ -binding motif underlies the unusual pro...thetic bacterial core light-harvesting complexes.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7vrj', asym_id='Y', title='A Ca 2+ -binding motif underlies the unusual pro...thetic bacterial core light-harvesting complexes.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0016020,0019684,0019866,0030077,0045156', uniprot = '', pdbid = '7vrj', asym_id = 'Y'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020,0019684,0019866,0030077,0045156', uniprot='', pdbid='7vrj', asym_id='Y')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>