Structure of PDB 7und Chain Y

Receptor sequence

>7undY (length=116) Species: 9606 (Homo sapiens) [Search protein sequence]

ALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYD
CTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVREL
KSRGVAYKSRDTAIKT

3D structure

PDB

7und Structural basis of nucleosome retention during transcription elongation.

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	Y	L18 C19	L17 C18

Gene Ontology

	Molecular Function
GO:0000993	RNA polymerase II complex binding
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0046872	metal ion binding
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0006355	regulation of DNA-templated transcription
GO:0006368	transcription elongation by RNA polymerase II
GO:0032785	negative regulation of DNA-templated transcription, elongation
GO:0032786	positive regulation of DNA-templated transcription, elongation
GO:0034243	regulation of transcription elongation by RNA polymerase II
GO:0034244	negative regulation of transcription elongation by RNA polymerase II
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0140673	transcription elongation-coupled chromatin remodeling

External links

PDB	RCSB:7und, PDBe:7und, PDBj:7und
PDBsum	7und
PubMed	35709268
UniProt	P63272\|SPT4H_HUMAN Transcription elongation factor SPT4 (Gene Name=SUPT4H1)