Structure of PDB 7pwg Chain Y

Receptor sequence

>7pwgY (length=133) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]

MKLNSAVTASRRKCRKAYFTANAETRAKMMSSRLSKELRAEHKIKTMPIR
RGDIVEIFTGGHKGTGKVVEVRRRDYKICVEGINQKARNPEAKPVPYPIH
PSNCIIKELYMNGSRYRAIKRRQERNAERLARI

3D structure

PDB

7pwg Cryo-EM structure of the ancient eukaryotic ribosome from the human parasite Giardia lamblia.

Chain

Resolution

2.75 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y	M1 K2 L3 N4 T8 K13 R15 Y18 R33 K45 T46 T59 G61 Q85 K86 R88 Y97 H100 S102 N103 R125 N126 R129 R132	M1 K2 L3 N4 T8 K13 R15 Y18 R33 K45 T46 T59 G61 Q85 K86 R88 Y97 H100 S102 N103 R125 N126 R129 R132
BS02	rna	Y	R12 R15 F19 E24 R50 R51 R73 R74 N112 G113 S114 Y116 R117 R121	R12 R15 F19 E24 R50 R51 R73 R74 N112 G113 S114 Y116 R117 R121

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit

External links