Structure of PDB 7p7q Chain Y

Receptor sequence

>7p7qY (length=74) Species: 1351 (Enterococcus faecalis)

SNGRDSESKRLGAKSADGQTVTGGSILYRQRGTKIYPGVNVGIGGDDTLF
AKVDGVVRFERKGRDKKQVSVYPV

3D structure

• PDB: 7p7q Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.
• Chain: Y
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y	N21 R23 D24 S25 E26 S27 K28 R29 L30 K33 A35 D36 G37 Q38 T41 G42 G43 S44 I45 Y47 R48 R50 G51 T52 Y55 G63 G64 D65 F69 F78 K86	N2 R4 D5 S6 E7 S8 K9 R10 L11 K14 A16 D17 G18 Q19 T22 G23 G24 S25 I26 Y28 R29 R31 G32 T33 Y36 G44 G45 D46 F50 F59 K67
BS02	rna	Y	R80 G82 R83	R61 G63 R64

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7p7q, PDBe:7p7q, PDBj:7p7q
• PDBsum: 7p7q
• PubMed: 35387982
• UniProt: Q836X4|RL27_ENTFA Large ribosomal subunit protein bL27 (Gene Name=rpmA)