Structure of PDB 7nbu Chain Y

Receptor sequence
>7nbuY (length=121) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
AAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGS
IKPIRGDILELRWHEANNHFRVLFFRWGQHPVALTAFYANQQKTPKTKIE
TALDRQKIWKRAFGDTPPILE
3D structure
PDB7nbu Substrate recognition and cryo-EM structure of the ribosome-bound TAC toxin of Mycobacterium tuberculosis.
ChainY
Resolution3.11 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y A17 R22 K27 A54 K58 P59 H70 N73 N96 K102 T107 R111 A11 R16 K21 A48 K52 P53 H64 N67 N90 K96 T101 R105
BS02 rna Y R61 K113 R55 K107
BS03 rna Y K58 R68 N73 Q98 K99 K52 R62 N67 Q92 K93
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
Biological Process
GO:0001666 response to hypoxia
GO:0045926 negative regulation of growth
GO:0098754 detoxification

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7nbu, PDBe:7nbu, PDBj:7nbu
PDBsum7nbu
PubMed35552387
UniProtP9WJA5|HIGB1_MYCTU Probable endoribonuclease HigB1 (Gene Name=higB1)

[Back to BioLiP]