Structure of PDB 7mt2 Chain Y

Receptor sequence
>7mt2Y (length=68) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
VSPGELRELTDEELAERLRESKEELFNLRFQMATGQLNNNRRLRTVRQEI
ARIYTVLRERELGLATGP
3D structure
PDB7mt2 Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
ChainY
Resolution2.76 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y R11 N42 N43 N44 R45 R48 R51 A55 R56 Y58 T59 R62 L66 R7 N38 N39 N40 R41 R44 R47 A51 R52 Y54 T55 R58 L62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7mt2, PDBe:7mt2, PDBj:7mt2
PDBsum7mt2
PubMed35064151
UniProtP9WHA7|RL29_MYCTU Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]