Structure of PDB 7e0j Chain Y

Receptor sequence

>7e0jY (length=220) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

GIEFYGPNRAKWLGPYSENATPAYLTGEFPGDYGWDTAGLSADPETFKRY
RELELIHARWAMLGALGCITPELLAKSGTQFGEAVWFKAGAQIFSEGGLD
YLGNPSLVHAQNIVATLAVQVILMGLVEGYRVNGGPAGEGLDPLYPGESF
DPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIQNLDD
HLSNPTVNNAFAFATKFTPS

3D structure

PDB

7e0j Structural basis of LhcbM5-mediated state transitions in green algae.

Chain

Resolution

3.13 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	Y	F247 A250 T251 F253 T254	F211 A214 T215 F217 T218
BS02	CHL	Y	W71 T73	W35 T37
BS03	CHL	Y	K47 W48 L49 G50 P51 Y69 W71 F214	K11 W12 L13 G14 P15 Y33 W35 F178
BS04	CLA	Y	L61 G67 D68 Y69 W71 S77 Y86 R87 E90 R210 M213 F214	L25 G31 D32 Y33 W35 S41 Y50 R51 E54 R174 M177 F178
BS05	CLA	Y	Y86 H93 F217 F220	Y50 H57 F181 F184
BS06	CLA	Y	L99 G100 G103 F117 Q128 Y137	L63 G64 G67 F81 Q92 Y101
BS07	CHL	Y	S142 L143 V144 H145 A146 Q147 N148	S106 L107 V108 H109 A110 Q111 N112
BS08	CHL	Y	W96 G126 T152 Q156 M160	W60 G90 T116 Q120 M124
BS09	CHL	Y	F123 K124 G126 A127 Q156	F87 K88 G90 A91 Q120
BS10	CHL	Y	R95 W96 V163 Y166 R167 G171 P172 A173 P182 F186	R59 W60 V127 Y130 R131 G135 P136 A137 P146 F150
BS11	CHL	Y	L89 I92 H93 W96 Q156 M160 G161 E164 R167	L53 I56 H57 W60 Q120 M124 G125 E128 R131
BS12	CLA	Y	R95 M98 L99 Y181 P182 G183 F186 D187 L191 F198 L201 E205	R59 M62 L63 Y145 P146 G147 F150 D151 L155 F162 L165 E169
BS13	CLA	Y	F40 K204 K207 N208	F4 K168 K171 N172
BS14	CLA	Y	L102 K204 N208 L211	L66 K168 N172 L175
BS15	CLA	Y	F214 G218 Q222 T226 N233 H237 N244 N245 A246	F178 G182 Q186 T190 N197 H201 N208 N209 A210
BS16	CLA	Y	H237 P241 F247	H201 P205 F211

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7e0j, PDBe:7e0j, PDBj:7e0j
PDBsum	7e0j
PubMed	34239095
UniProt	Q93WL4

[Back to BioLiP]