Structure of PDB 7c07 Chain Y

Receptor sequence
>7c07Y (length=179) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]
VNCSFYYKIGACRHGERCSRKHVKPNFSQTILCPNMYKNPIHEPNGKKFT
QRELAEQFDAFYEDMFCEFSKYGEVEQLVVCDNVGDHLVGNVYVRFKYEE
SAQNAIDDLNSRWYSQRPVYAELSPVTDFREACCRQHETSECQRGGLCNF
MHAKKPSPQLLRDLVLAQRKYLALNAAEE
3D structure
PDB7c07 Elucidation of the aberrant 3' splice site selection by cancer-associated mutations on the U2AF1.
ChainY
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y S19 F20 K23 C27 R28 H29 R32 C33 S34 C148 R150 Q151 R159 C163 N164 F165 S4 F5 K8 C12 R13 H14 R17 C18 S19 C133 R135 Q136 R144 C148 N149 F150
BS02 ZN Y C18 C27 C33 H37 C3 C12 C18 H22
BS03 ZN Y C149 C163 H167 C134 C148 H152
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030628 pre-mRNA 3'-splice site binding
GO:0046872 metal ion binding
Biological Process
GO:0000389 mRNA 3'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005829 cytosol
GO:0071004 U2-type prespliceosome
GO:0089701 U2AF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7c07, PDBe:7c07, PDBj:7c07
PDBsum7c07
PubMed32958768
UniProtQ09176|U2AF1_SCHPO Splicing factor U2AF 23 kDa subunit (Gene Name=SPAP8A3.06)

[Back to BioLiP]