Structure of PDB 7as8 Chain Y

Receptor sequence
>7as8Y (length=101) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MHVKKGDKVMVISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHSKPTQA
NPQGGISNQEAPIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQV
L
3D structure
PDB7as8 Structural Basis for Bacterial Ribosome-Associated Quality Control by RqcH and RqcP.
ChainY
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y H2 K4 I12 S13 G14 K15 K17 A26 K29 V41 K42 K43 H44 S45 K46 P47 G55 I56 S66 N67 E77 V78 R80 G82 Y83 K90 K95 H2 K4 I12 S13 G14 K15 K17 A26 K29 V41 K42 K43 H44 S45 K46 P47 G55 I56 S66 N67 E77 V78 R80 G82 Y83 K90 K95
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0009295 nucleoid
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7as8, PDBe:7as8, PDBj:7as8
PDBsum7as8
PubMed33259810
UniProtP0CI78|RL24_BACSU Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]