Structure of PDB 6ywx Chain Y

Receptor sequence
>6ywxY (length=46) Species: 367110 (Neurospora crassa OR74A) [Search protein sequence]
GPRPTMSGATRLVQKRRHGFLSRVKTKNGQKTLKRRLAKGRLRLSA
3D structure
PDB6ywx Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.
ChainY
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y G95 P96 R97 T99 M100 S101 A103 T104 R105 L106 Q108 K109 R110 R111 H112 F114 L115 R117 K121 N122 K125 K128 R129 R130 K133 G134 R135 L136 G1 P2 R3 T5 M6 S7 A9 T10 R11 L12 Q14 K15 R16 R17 H18 F20 L21 R23 K27 N28 K31 K34 R35 R36 K39 G40 R41 L42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005739 mitochondrion
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ywx, PDBe:6ywx, PDBj:6ywx
PDBsum6ywx
PubMed33056988
UniProtQ1K7P9|RM34_NEUCR Large ribosomal subunit protein bL34m (Gene Name=mrpl34)

[Back to BioLiP]