Structure of PDB 6xkw Chain Y

Receptor sequence
>6xkwY (length=30) Species: 272942 (Rhodobacter capsulatus SB 1003) [Search protein sequence]
MLVKTHITKIGVTLFAVALFYGFIYMLSNS
3D structure
PDB6xkw Cryo-EM structures of engineered active bc 1 -cbb 3 type CIII 2 CIV super-complexes and electronic communication between the complexes.
ChainY
Resolution5.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide Y I7 T8 G11 V12 F15 A16 L19 F20 F23 L27 I7 T8 G11 V12 F15 A16 L19 F20 F23 L27
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xkw, PDBe:6xkw, PDBj:6xkw
PDBsum6xkw
PubMed33568648
UniProtQ05389|CYCY_RHOCB Cytochrome c-type cyt cy (Gene Name=cycY)

[Back to BioLiP]