Structure of PDB 6wqq Chain Y

Receptor sequence
>6wqqY (length=136) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESA
RIAMTRYMKRGGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPG
RILFEVAGVSEEVAREALRLASHKLPVKTKFVKREE
3D structure
PDB6wqq Characterization of the Core Ribosomal Binding Region for the Oxazolidone Family of Antibiotics Using Cryo-EM.
ChainY
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y P4 K5 R6 Y9 R11 H13 R14 K22 F29 Q46 S49 R56 K63 W65 F69 H71 K77 R82 M83 G84 A85 G86 K87 R101 H123 K124 P126 K128 P4 K5 R6 Y9 R11 H13 R14 K22 F29 Q46 S49 R56 K63 W65 F69 H71 K77 R82 M83 G84 A85 G86 K87 R101 H123 K124 P126 K128
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6wqq, PDBe:6wqq, PDBj:6wqq
PDBsum6wqq
PubMed32566908
UniProtQ2FW13|RL16_STAA8 Large ribosomal subunit protein uL16 (Gene Name=rplP)

[Back to BioLiP]