Structure of PDB 6wde Chain Y

Receptor sequence
>6wdeY (length=85) Species: 562 (Escherichia coli) [Search protein sequence]
NIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFN
EMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA
3D structure
PDB6wde Cryo-EM of elongating ribosome with EF-Tu•GTP elucidates tRNA proofreading.
ChainY
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y N2 K4 K8 R9 Q12 K15 H19 N20 S22 R23 R24 S25 R28 T29 K32 Y35 Q54 P55 R59 K63 H67 K68 N69 K70 A72 R73 H74 N77 Q81 N1 K3 K7 R8 Q11 K14 H18 N19 S21 R22 R23 S24 R27 T28 K31 Y34 Q53 P54 R58 K62 H66 K67 N68 K69 A71 R72 H73 N76 Q80
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008073 ornithine decarboxylase inhibitor activity
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6wde, PDBe:6wde, PDBj:6wde
PDBsum6wde
PubMed32612237
UniProtP0A7U7|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]