Structure of PDB 6tnn Chain Y

Receptor sequence

>6tnnY (length=205) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]

PKVALYNQNGSTAGDIELNASVFGIEPNESVVFDAILMQRASLRQGTHKV
KNRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKL
PKKVRRLAIKSVLSSKVIDNNIIVLEDLTLDTAKTKEMAAILKGLSVEKK
ALIVTADANEAVALSARNIPGVTVVEANGINVLDVVNHEKLLITKAAVEK
VEEVL

3D structure

PDB

6tnn Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.

Chain

Resolution

3.07 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y	S31 R41 R45 Q46 T48 V51 K52 N53 R54 S55 V57 R58 R62 K63 Q67 K68 T70 G71 R72 R74 G76 R79 Q82 R84 V89 F90 P92 R95 Y99 K100 P102 K103 K104 R106 R107 A134 T136 K137 R168 N169	S30 R40 R44 Q45 T47 V50 K51 N52 R53 S54 V56 R57 R61 K62 Q66 K67 T69 G70 R71 R73 G75 R78 Q81 R83 V88 F89 P91 R94 Y98 K99 P101 K102 K103 R105 R106 A133 T135 K136 R167 N168

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6tnn, PDBe:6tnn, PDBj:6tnn
PDBsum	6tnn
PubMed	32991829
UniProt	P42921\|RL4_BACSU Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]