Structure of PDB 6swe Chain Y

Receptor sequence
>6sweY (length=50) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence]
MGQKWKLYIVKDGKVIRKNKFCPRCGPGVFMADHGDRWACGRCGYTEWKK
3D structure
PDB6swe Cryo-EM study of an archaeal 30S initiation complex gives insights into evolution of translation initiation.
ChainY
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y M1 G2 Q3 V29 F30 M31 A32 D33 H34 R37 G41 T46 M1 G2 Q3 V29 F30 M31 A32 D33 H34 R37 G41 T46
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6swe, PDBe:6swe, PDBj:6swe
PDBsum6swe
PubMed32029867
UniProtP61238|RS27A_PYRAB Small ribosomal subunit protein eS31 (Gene Name=rps27ae)

[Back to BioLiP]