Structure of PDB 6ppk Chain Y

Receptor sequence
>6ppkY (length=65) Species: 1423 (Bacillus subtilis) [Search protein sequence]
MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIREVRKAI
ARMKTVIREREIAAN
3D structure
PDB6ppk Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.
ChainY
Resolution4.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y K2 N39 T40 A41 R44 R47 K48 A51 R52 K54 R58 K2 N39 T40 A41 R44 R47 K48 A51 R52 K54 R58
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ppk, PDBe:6ppk, PDBj:6ppk
PDBsum6ppk
PubMed31665744
UniProtP12873|RL29_BACSU Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]