Structure of PDB 6ny6 Chain Y

Receptor sequence
>6ny6Y (length=84) Species: 562 (Escherichia coli) [Search protein sequence]
MKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKH
NLSGFWSRRITEEHRLVYAVTDDSLLIAACRYHY
3D structure
PDB6ny6 Monomeric YoeB toxin retains RNase activity but adopts an obligate dimeric form for thermal stability.
ChainY
Resolution3.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y E18 R22 K26 K42 G43 K44 E46 P47 L48 K49 E62 E18 R22 K26 K42 G43 K44 E46 P47 L48 K49 E62
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
GO:0016892 RNA endonuclease activity, producing 3'-phosphomonoesters
GO:0042803 protein homodimerization activity
GO:0043024 ribosomal small subunit binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006401 RNA catabolic process
GO:0006402 mRNA catabolic process
GO:0009408 response to heat
GO:0040008 regulation of growth
GO:0044010 single-species biofilm formation
GO:0045947 negative regulation of translational initiation
GO:0098795 global gene silencing by mRNA cleavage
Cellular Component
GO:0110001 toxin-antitoxin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ny6, PDBe:6ny6, PDBj:6ny6
PDBsum6ny6
PubMed31501867
UniProtP69348|YOEB_ECOLI Toxin YoeB (Gene Name=yoeB)

[Back to BioLiP]