Structure of PDB 6n8o Chain Y

Receptor sequence
>6n8oY (length=128) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SKVTAVRCKKCRTKLALSTSFIAHDPPSKESSEGHFIKRAANSHRIIDIQ
ESQANCSHFFIEPLKWMQPELQGKQELEGKFSCPGCSSKVGGYNWKGSRC
SCGKWVIPAIHLQTSKVDQFPLQSTALP
3D structure
PDB6n8o Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
ChainY
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y F260 H268 R269 I270 I271 Q277 H282 K304 K313 K320 S325 W329 Q337 K340 F36 H44 R45 I46 I47 Q53 H58 K80 K89 K96 S101 W105 Q113 K116
Gene Ontology
Molecular Function
GO:0004721 phosphoprotein phosphatase activity
GO:0004725 protein tyrosine phosphatase activity
GO:0005515 protein binding
GO:0008138 protein tyrosine/serine/threonine phosphatase activity
GO:1990275 preribosome binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000055 ribosomal large subunit export from nucleus
GO:0006470 protein dephosphorylation
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0016311 dephosphorylation
GO:0030476 ascospore wall assembly
GO:0051321 meiotic cell cycle
GO:2000786 positive regulation of autophagosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0010494 cytoplasmic stress granule

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n8o, PDBe:6n8o, PDBj:6n8o
PDBsum6n8o
PubMed30814529
UniProtQ02256|PVH1_YEAST Tyrosine-protein phosphatase YVH1 (Gene Name=YVH1)

[Back to BioLiP]