Structure of PDB 6n8k Chain Y

Receptor sequence

>6n8kY (length=126) Species: 559292 (Saccharomyces cerevisiae S288C)

AKQSLDVSSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPIR
RDDEVLVVRGSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHP
SKLVITKLHLDKDRKALIQRKGGKLE

3D structure

• PDB: 6n8k Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
• Chain: Y
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y	A2 Q4 L6 V8 S9 S10 R12 K14 Y19 V29 L30 K46 R60 S62 V90 H100 S102 K103 R121	A1 Q3 L5 V7 S8 S9 R11 K13 Y18 V28 L29 K45 R59 S61 V89 H99 S101 K102 R120
BS02	rna	Y	R13 R16 K17 F20 P23 S25 R28 R51 R52 Y74 R75 L111 D112 K113 D114	R12 R15 K16 F19 P22 S24 R27 R50 R51 Y73 R74 L110 D111 K112 D113

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0032991 protein-containing complex
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6n8k, PDBe:6n8k, PDBj:6n8k
• PDBsum: 6n8k
• PubMed: 30814529
• UniProt: P05743|RL26A_YEAST Large ribosomal subunit protein uL24A (Gene Name=RPL26A)