Structure of PDB 6juw Chain Y

Receptor sequence
>6juwY (length=46) Species: 9913 (Bos taurus) [Search protein sequence]
HYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK
3D structure
PDB6juw X-ray structures of catalytic intermediates of cytochromecoxidase provide insights into its O2activation and unidirectional proton-pump mechanisms.
ChainY
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 DMU Y A35 R41 H42 L45 A34 R40 H41 L44
Gene Ontology
Biological Process
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
Cellular Component
GO:0045277 respiratory chain complex IV

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6juw, PDBe:6juw, PDBj:6juw
PDBsum6juw
PubMed32165497
UniProtP00430|COX7C_BOVIN Cytochrome c oxidase subunit 7C, mitochondrial (Gene Name=COX7C)

[Back to BioLiP]