Structure of PDB 6fyy Chain Y

Receptor sequence

>6fyyY (length=134) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]

SDAITIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEAYKAE
KDAVSVFGFRTQYGGGKSTGFGLVYNSVADAKKFEPAYRLVRYGLAEKVE
KASRQQRKQRKNRGKKIFGTGKSIAKKAARRNAD

3D structure

PDB

6fyy Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.

Chain

Resolution

3.02 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y	R8 R10 K11 V12 A33 N34 S36 K37 F58 G59 F60 R61 T62 Y64 G65 Y89 R93 K102 R105 Q106 R108 K109 Q110 K112 N113 K116 K117 F119 G120 T121 K128 R131 R132	R7 R9 K10 V11 A32 N33 S35 K36 F57 G58 F59 R60 T61 Y63 G64 Y88 R92 K101 R104 Q105 R107 K108 Q109 K111 N112 K115 K116 F118 G119 T120 K127 R130 R131

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links