Structure of PDB 6ekg Chain Y |
>6ekgY (length=121) Species: 39152 (Methanococcus maripaludis) [Search protein sequence] |
SIVKTMIVDDSAFMRNILKRILSTTNKYVVIGEAANGADAIKMAEELQPD LISMDIVMPETDGITATKAIKEKTPEIKIVMCTSVDQEQKMIDAVNAGAD GYIVKPFQAPKILEQFNKLFP |
|
PDB | 6ekg Structure and function of the archaeal response regulator CheY. |
Chain | Y |
Resolution | 1.15 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
Y |
D12 D57 V59 |
D10 D55 V57 |
|
|
|
|