Structure of PDB 6ddd Chain Y

Receptor sequence

>6dddY (length=136) Species: 1280 (Staphylococcus aureus) [Search protein sequence]

MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESA
RIAMTRYMKRGGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPG
RILFEVAGVSEEVAREALRLASHKLPVKTKFVKREE

3D structure

PDB

6ddd cryoEM-Guided Development of Antibiotics for Drug-Resistant Bacteria.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y	P4 K5 R6 Y9 R11 H13 R14 K16 T17 K22 G23 G24 F29 W41 R45 Q46 S49 R56 W65 F69 H71 K76 K77 E80 V81 R82 M83 G84 A85 G86 K87 R101 L120 H123 K124 P126 K128	P4 K5 R6 Y9 R11 H13 R14 K16 T17 K22 G23 G24 F29 W41 R45 Q46 S49 R56 W65 F69 H71 K76 K77 E80 V81 R82 M83 G84 A85 G86 K87 R101 L120 H123 K124 P126 K128

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6ddd, PDBe:6ddd, PDBj:6ddd
PDBsum	6ddd
PubMed	30667174
UniProt	Q2FW13\|RL16_STAA8 Large ribosomal subunit protein uL16 (Gene Name=rplP)