Structure of PDB 6bok Chain Y

Receptor sequence

>6bokY (length=97) Species: 262724 (Thermus thermophilus HB27)

SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLRLEGLSPKEIKKELLKLL

3D structure

• PDB: 6bok Conformational Control of Translation Termination on the 70S Ribosome.
• Chain: Y
• Resolution: 3.55 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y	S2 K3 K10 R11 I13 V14 A15 N16 R20 R21 A24 K25 G28 V30 K32 K33 T34 T35 K39 R40 R41 Q42 Y43 P44 N45 Q47 K48 R50 R52 G55 R61 A64 S65 H66 K69 R76 G79 R81 K92 E93	S1 K2 K9 R10 I12 V13 A14 N15 R19 R20 A23 K24 G27 V29 K31 K32 T33 T34 K38 R39 R40 Q41 Y42 P43 N44 Q46 K47 R49 R51 G54 R60 A63 S64 H65 K68 R75 G78 R80 K91 E92
BS02	MG	Y	I13 V14	I12 V13

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6bok, PDBe:6bok, PDBj:6bok
• PDBsum: 6bok
• PubMed: 29731232
• UniProt: Q72G84|RL28_THET2 Large ribosomal subunit protein bL28 (Gene Name=rpmB)