Structure of PDB 5zeb Chain Y

Receptor sequence
>5zebY (length=63) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
AAVCDICGKGPGFGKSVSHSHRRTSRRWNPNIQPVRAVTRPGGNKQRINA
CTSCIKAGKVSRA
3D structure
PDB5zeb Structures of Mycobacterium smegmatis 70S ribosomes in complex with HPF, tmRNA, and P-tRNA.
ChainY
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y A2 A3 V4 K10 P12 F14 K16 S19 S21 H22 R23 R24 S26 R27 R28 W29 N30 P31 N32 Q34 P35 V36 R37 R41 N45 K46 R48 T53 K57 R63 A1 A2 V3 K9 P11 F13 K15 S18 S20 H21 R22 R23 S25 R26 R27 W28 N29 P30 N31 Q33 P34 V35 R36 R40 N44 K45 R47 T52 K56 R62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zeb, PDBe:5zeb, PDBj:5zeb
PDBsum5zeb
PubMed30206241
UniProtA0QV03

[Back to BioLiP]