Structure of PDB 5x8p Chain Y

Receptor sequence

>5x8pY (length=74) Species: 3562 (Spinacia oleracea) [Search protein sequence]

RRICPFTGKKSNKANRVSHSNHKTKRLQFVNLQYKRVWWEAGKRFVKLRL
STKALKTIEKNGLDAVAKKAGIDL

3D structure

PDB

5x8p Unique localization of the plastid-specific ribosomal proteins in the chloroplast ribosome small subunit provides mechanistic insights into the chloroplastic translation

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y	R72 R73 K80 N83 K84 A85 N86 R87 V88 S89 S91 N92 H93 K94 K96 R97 Q99 F100 V101 N102 Q104 Y105 K106 R107 K118 R120 T123 K124 K127 K131 K139	R1 R2 K9 N12 K13 A14 N15 R16 V17 S18 S20 N21 H22 K23 K25 R26 Q28 F29 V30 N31 Q33 Y34 K35 R36 K47 R49 T52 K53 K56 K60 K68

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5x8p, PDBe:5x8p, PDBj:5x8p
PDBsum	5x8p
PubMed	28582576
UniProt	P82245\|RK28_SPIOL Large ribosomal subunit protein bL28c (Gene Name=RPL28)

[Back to BioLiP]