Structure of PDB 5u9f Chain Y

Receptor sequence
>5u9fY (length=47) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
SRYQHTKGQIKDNAIEALLHDPLFRQRVEKNKKGKGSYMRKGKHGNR
3D structure
PDB5u9f Mechanism of ribosome rescue by ArfA and RF2.
ChainY
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y T7 K8 G9 H21 R26 R28 E30 K34 K36 G37 Y39 R41 K44 H45 T6 K7 G8 H20 R25 R27 E29 K33 K35 G36 Y38 R40 K43 H44
BS02 rna Y Q10 K12 E17 H21 Q9 K11 E16 H20
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0019843 rRNA binding
GO:0043023 ribosomal large subunit binding
Biological Process
GO:0006417 regulation of translation
GO:0072344 rescue of stalled ribosome

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5u9f, PDBe:5u9f, PDBj:5u9f
PDBsum5u9f
PubMed28300532
UniProtP36675|ARFA_ECOLI Alternative ribosome-rescue factor A (Gene Name=arfA)

[Back to BioLiP]