Structure of PDB 5ool Chain Y

Receptor sequence
>5oolY (length=176) Species: 9606 (Homo sapiens) [Search protein sequence]
GLEEFFDDPKNWGQEKVKSGAAWTCQQLRNKSNEDLHKLWYVLLKERNML
LTLEQEAKRQRLPMPSPERLDKVVDSMDALDKVVQEREDALRLLQTGQER
ARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRYNRKRFFALPYVDHFLRLE
REKRARIKARKENLERKKAKILLKKF
3D structure
PDB5ool Structures of the human mitochondrial ribosome in native states of assembly.
ChainY
Resolution3.06 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y Q117 K120 R121 R123 R164 I172 K180 K182 W184 V185 I186 L190 K192 R193 R196 K197 R198 R213 R216 R222 N225 L226 K229 K230 Q55 K58 R59 R61 R102 I110 K118 K120 W122 V123 I124 L128 K130 R131 R134 K135 R136 R151 R154 R160 N163 L164 K167 K168
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0008150 biological_process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ool, PDBe:5ool, PDBj:5ool
PDBsum5ool
PubMed28892042
UniProtQ9HD33|RM47_HUMAN Large ribosomal subunit protein uL29m (Gene Name=MRPL47)

[Back to BioLiP]