Structure of PDB 5lqw Chain Y

Receptor sequence
>5lqwY (length=89) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
FDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQA
KNCIICNNVGVNDAFYCWECCRLGKDKDGCPRILNLGSN
3D structure
PDB5lqw Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
ChainY
Resolution5.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y N64 V65 N58 V59
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0009410 response to xenobiotic stimulus
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0071011 precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lqw, PDBe:5lqw, PDBj:5lqw
PDBsum5lqw
PubMed27562955
UniProtQ06835|RDS3_YEAST Pre-mRNA-splicing factor RDS3 (Gene Name=RDS3)

[Back to BioLiP]