Structure of PDB 5lj5 Chain Y

Receptor sequence

>5lj5Y (length=84) Species: 4932 (Saccharomyces cerevisiae)

NTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMR
TIDQASLAQISLNGERFFGKPLKVEFSKSETKTL

3D structure

• PDB: 5lj5 Cryo-EM structure of the spliceosome immediately after branching.
• Chain: Y
• Resolution: 10.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y	Y31 E37 M41	Y4 E10 M14

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0030620 U2 snRNA binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005686 U2 snRNP
• GO:0071004 U2-type prespliceosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5lj5, PDBe:5lj5, PDBj:5lj5
• PDBsum: 5lj5
• PubMed: 27459055
• UniProt: P40567|MSL1_YEAST U2 small nuclear ribonucleoprotein B'' (Gene Name=MSL1)