Structure of PDB 5jb3 Chain Y

Receptor sequence
>5jb3Y (length=50) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence]
MGQKWKLYEIKDGKVIRKNKFCPRCGPGVFMADHGDRWACGKCGYTEWKK
3D structure
PDB5jb3 Cryo-EM study of start codon selection during archaeal translation initiation.
ChainY
Resolution5.34 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y M1 G2 Q3 K4 W5 L7 N19 G28 F30 A32 D33 H34 R37 W38 A39 G41 T46 M1 G2 Q3 K4 W5 L7 N19 G28 F30 A32 D33 H34 R37 W38 A39 G41 T46
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jb3, PDBe:5jb3, PDBj:5jb3
PDBsum5jb3
PubMed27819266
UniProtQ8U443|RS27A_PYRFU Small ribosomal subunit protein eS31 (Gene Name=rps27ae)

[Back to BioLiP]