Structure of PDB 4yy3 Chain Y

Receptor sequence
>4yy3Y (length=92) Species: 585 (Proteus vulgaris) [Search protein sequence]
GIKSFKHKGLKLLFEKGVTSGVPAQDVDRINDRLQAIDTATEIGELNRQI
YKLHPLKGDREGYWSITVRANWRITFQFINGDAYILNYEDYH
3D structure
PDB4yy3 mRNA bound to the 30S subunit is a HigB toxin substrate.
ChainY
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y K8 S20 A24 Q25 R29 I50 K52 R69 A70 N71 Y91 K8 S20 A24 Q25 R29 I50 K52 R69 A70 N71 Y91
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
GO:0030371 translation repressor activity
GO:0043022 ribosome binding
Biological Process
GO:0006276 plasmid maintenance
GO:0006401 RNA catabolic process
GO:0008285 negative regulation of cell population proliferation
GO:0017148 negative regulation of translation
GO:0030308 negative regulation of cell growth

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4yy3, PDBe:4yy3, PDBj:4yy3
PDBsum4yy3
PubMed27307497
UniProtQ7A225|HIGB_PROVU Endoribonuclease HigB (Gene Name=higB)

[Back to BioLiP]