Structure of PDB 3j6b Chain Y

Receptor sequence

>3j6bY (length=45) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH

3D structure

PDB

3j6b Structure of the yeast mitochondrial large ribosomal subunit.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y	S61 R62 G63 N64 T65 Y66 Q67 P68 T70 L71 K72 R73 K74 R75 F77 G78 F79 L80 R82 A83 K84 K86 Q87 K90 I91 R94 R95 L97 K98 G99 R100 W101 H105	S1 R2 G3 N4 T5 Y6 Q7 P8 T10 L11 K12 R13 K14 R15 F17 G18 F19 L20 R22 A23 K24 K26 Q27 K30 I31 R34 R35 L37 K38 G39 R40 W41 H45

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3j6b, PDBe:3j6b, PDBj:3j6b
PDBsum	3j6b
PubMed	24675956
UniProt	Q04598\|RM34_YEAST Large ribosomal subunit protein bL34m (Gene Name=YDR115W)