Structure of PDB 3j6b Chain Y

Receptor sequence
>3j6bY (length=45) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
3D structure
PDB3j6b Structure of the yeast mitochondrial large ribosomal subunit.
ChainY
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3j6b, PDBe:3j6b, PDBj:3j6b
PDBsum3j6b
PubMed24675956
UniProtQ04598|RM34_YEAST Large ribosomal subunit protein bL34m (Gene Name=YDR115W)

[Back to BioLiP]