Structure of PDB 3dll Chain Y

Receptor sequence
>3dllY (length=58) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
AKHPVPKKKTSKSKRDMRRSHHALTAPNLTECPQCHGKKLSHHICPNCGY
YDGRQVLA
3D structure
PDB3dll The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect tRNA positioning
ChainY
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y A2 K3 H4 V6 P7 K8 K9 K10 T11 K13 S14 K15 R16 M18 R19 R20 S21 H22 N29 K40 S42 H43 Y52 A1 K2 H3 V5 P6 K7 K8 K9 T10 K12 S13 K14 R15 M17 R18 R19 S20 H21 N28 K39 S41 H42 Y51
BS02 ZN Y C33 G38 C32 G37
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3dll, PDBe:3dll, PDBj:3dll
PDBsum3dll
PubMed18757750
UniProtP49228|RL32_DEIRA Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]