Structure of PDB 2ybb Chain Y

Receptor sequence

>2ybbY (length=104) Species: 9913 (Bos taurus)

GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTD
ANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKK
ATNE

3D structure

• PDB: 2ybb Arrangement of Electron Transport Chain Components in Bovine Mitochondrial Supercomplex I(1)III(2)Iv(1).
• Chain: Y
• Resolution: 19.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	Y	K13 C14 C17 H18 P30 T40 G41 Y48 T49 N52 W59 Y67 L68 T78 K79 M80 F82	K13 C14 C17 H18 P30 T40 G41 Y48 T49 N52 W59 Y67 L68 T78 K79 M80 F82

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
• GO:0006915 apoptotic process

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:2ybb, PDBe:2ybb, PDBj:2ybb
• PDBsum: 2ybb
• PubMed: 21909073
• UniProt: P62894|CYC_BOVIN Cytochrome c (Gene Name=CYCS)