Structure of PDB 1nwy Chain Y |
>1nwyY (length=73) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] |
MQKDLHPKAVPCKIIYQGQVVMETMSTRPEIHVDVWSGVHPFWTGEERFL DTEGRVDKFNKRFGDSYRRGSKK |
|
PDB | 1nwy Structural basis for the antibiotic activity of ketolides and azalides. |
Chain | Y |
Resolution | 3.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
Y |
K3 V39 |
K3 V39 |
|
|
|
|