Structure of PDB 1m90 Chain Y

Receptor sequence
>1m90Y (length=82) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
ERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINE
AAWARGRANTPSKIRVRAARFEEEGEAIVEAE
3D structure
PDB1m90 Structural insights into peptide bond formation.
ChainY
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna Y T11 R15 R18 A19 P21 N22 H23 D27 K28 M30 R34 K39 H40 R49 L50 P52 N55 E56 W59 R61 R63 S68 T5 R9 R12 A13 P15 N16 H17 D21 K22 M24 R28 K33 H34 R43 L44 P46 N49 E50 W53 R55 R57 S62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1m90, PDBe:1m90, PDBj:1m90
PDBsum1m90
PubMed12185246
UniProtP18138|RL31_HALMA Large ribosomal subunit protein eL31 (Gene Name=rpl31e)

[Back to BioLiP]