Structure of PDB 1b7t Chain Y |
>1b7tY (length=138) Species: 31199 (Argopecten irradians) [Search protein sequence] |
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKE APGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDL LENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKG |
|
PDB | 1b7t Atomic structure of scallop myosin subfragment S1 complexed with MgADP: a novel conformation of the myosin head. |
Chain | Y |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
Y |
D30 D32 F34 D39 |
D18 D20 F22 D27 |
|
|
|
|