Structure of PDB 6otr Chain XT

Receptor sequence

>6otrXT (length=99) Species: 300852 (Thermus thermophilus HB8)

RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA

3D structure

• PDB: 6otr Monomeric YoeB toxin retains RNase activity but adopts an obligate dimeric form for thermal stability.
• Chain: XT
• Resolution: 3.12 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	XT	N9 L10 K14 R15 H16 R17 Q18 R22 N26 A28 S31 A32 K34 T35 K38 K39 E51 K54 R57 E60 S61 D64 K65 K68 S70 K74 N75 A78 R79 R80 K81 S82 R83 M85 R89 G101 G103 L104 S105	N2 L3 K7 R8 H9 R10 Q11 R15 N19 A21 S24 A25 K27 T28 K31 K32 E44 K47 R50 E53 S54 D57 K58 K61 S63 K67 N68 A71 R72 R73 K74 S75 R76 M78 R82 G94 G96 L97 S98

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6otr, PDBe:6otr, PDBj:6otr
• PDBsum: 6otr
• PubMed: 31501867
• UniProt: P80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)