Structure of PDB 6nsh Chain XT

Receptor sequence

>6nshXT (length=99) Species: 300852 (Thermus thermophilus HB8)

RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA

3D structure

• PDB: 6nsh Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
• Chain: XT
• Resolution: 3.397 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	XT	L10 K14 R15 R17 R22 R23 R25 N26 K27 S31 A32 K34 T35 K39 I55 R57 E60 D64 K65 S70 K74 N75 A78 R79 R80 K81 S82 R83 M85 R89 G101 G103 L104 S105	L3 K7 R8 R10 R15 R16 R18 N19 K20 S24 A25 K27 T28 K32 I48 R50 E53 D57 K58 S63 K67 N68 A71 R72 R73 K74 S75 R76 M78 R82 G94 G96 L97 S98

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6nsh, PDBe:6nsh, PDBj:6nsh
• PDBsum: 6nsh
• PubMed: 33016876
• UniProt: P80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)