Structure of PDB 6buw Chain XT

Receptor sequence

>6buwXT (length=99) Species: 300852 (Thermus thermophilus HB8)

RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA

3D structure

• PDB: 6buw Ribosomal ambiguity (ram) mutations promote the open (off) to closed (on) transition and thereby increase miscoding.
• Chain: XT
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	XT	L10 K14 R15 H16 Q18 S19 R22 R23 R25 N26 A28 S31 A32 K34 T35 L36 K39 I55 R57 E60 S61 K65 K68 S70 K74 N75 A76 A78 R79 K81 S82 M85 R86 R89 G101 G102 G103 L104 S105	L3 K7 R8 H9 Q11 S12 R15 R16 R18 N19 A21 S24 A25 K27 T28 L29 K32 I48 R50 E53 S54 K58 K61 S63 K67 N68 A69 A71 R72 K74 S75 M78 R79 R82 G94 G95 G96 L97 S98

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6buw, PDBe:6buw, PDBj:6buw
• PDBsum: 6buw
• PubMed: 30476222
• UniProt: P80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)