Structure of PDB 4yzv Chain XS

Receptor sequence

>4yzvXS (length=82) Species: 300852 (Thermus thermophilus HB8)

SLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYN
GKQHVPVYITENMVGHKLGEFAPTRTYRGHGK

3D structure

• PDB: 4yzv Defining the mRNA recognition signature of a bacterial toxin protein.
• Chain: XS
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	XS	S4 L5 K6 F10 H14 W34 R36 R37 Y52 N53 G54 K55 K70 G72 E73 T77 R78 T79 Y80 H83	S1 L2 K3 F7 H11 W31 R33 R34 Y49 N50 G51 K52 K67 G69 E70 T74 R75 T76 Y77 H80

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4yzv, PDBe:4yzv, PDBj:4yzv
• PDBsum: 4yzv
• PubMed: 26508639
• UniProt: Q5SHP2|RS19_THET8 Small ribosomal subunit protein uS19 (Gene Name=rpsS)