Structure of PDB 4www Chain XS

Receptor sequence

>4wwwXS (length=79) Species: 83333 (Escherichia coli K-12)

RSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVH
NGRQHVPVFVTDEMVGHKLGEFAPTRTYR

3D structure

• PDB: 4www Binding and action of CEM-101, a new fluoroketolide antibiotic that inhibits protein synthesis.
• Chain: XS
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	XS	S3 L4 K5 K6 F9 H13 K17 W33 S34 R35 R36 H51 G53 R54 G71 E72 T76 R77 R80	S2 L3 K4 K5 F8 H12 K16 W32 S33 R34 R35 H50 G52 R53 G70 E71 T75 R76 R79

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit

External links

• PDB: RCSB:4www, PDBe:4www, PDBj:4www
• PDBsum: 4www
• PubMed: 20855725
• UniProt: P0A7U3|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)