Structure of PDB 4tud Chain XS

Receptor sequence
>4tudXS (length=84) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAV
YNGKQHVPVYITENMVGHKLGEFAPTRTYRGHGK
3D structure
PDB4tud Structural insights into translational recoding by frameshift suppressor tRNASufJ.
ChainXS
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna XS P2 R3 S4 L5 K6 K7 V11 H14 W34 R36 R37 Y52 N53 G54 K55 K70 G72 E73 T77 R78 Y80 H83 P1 R2 S3 L4 K5 K6 V10 H13 W33 R35 R36 Y51 N52 G53 K54 K69 G71 E72 T76 R77 Y79 H82
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4tud, PDBe:4tud, PDBj:4tud
PDBsum4tud
PubMed25352689
UniProtQ5SHP2|RS19_THET8 Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]