Structure of PDB 4l71 Chain XQ

Receptor sequence
>4l71XQ (length=100) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKY
KLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKR
3D structure
PDB4l71 Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.
ChainXQ
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna XQ P2 K3 S12 M15 Q16 K17 R25 L31 Y32 K34 R38 S39 K40 K41 Y42 E61 R63 P64 I65 S66 K67 R68 K69 R70 R72 R91 R92 N94 Y95 L98 K100 P1 K2 S11 M14 Q15 K16 R24 L30 Y31 K33 R37 S38 K39 K40 Y41 E60 R62 P63 I64 S65 K66 R67 K68 R69 R71 R90 R91 N93 Y94 L97 K99
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4l71, PDBe:4l71, PDBj:4l71
PDBsum4l71
PubMed25128388
UniProtP0DOY7|RS17_THET8 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)

[Back to BioLiP]